PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma154g00280.1
Common NameZOSMA_154G00280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 414aa    MW: 46349.1 Da    PI: 8.4818
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma154g00280.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.7e-092713081954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +++  LAk+ gL+ +qV++WF N R +
  Zosma154g00280.1 271 FEHflHPYPTDTDKHLLAKQSGLSRNQVSNWFINARVR 308
                       665559******************************88 PP

2BELL64.13e-21161218966
              BELL   9 kakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkd 66 
                       k++L+s l+eV++r kqyv+q+q v+  Fe +agl  a+pY+slA ka+++hF  Lk+
  Zosma154g00280.1 161 KSRLVSTLDEVYRRCKQYVQQIQYVMTCFESIAGLHDAAPYASLAIKAMAKHFHRLKN 218
                       899*****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.9E-22105222IPR006563POX domain
PfamPF075262.9E-19160218IPR006563POX domain
PROSITE profilePS5007111.855249312IPR001356Homeobox domain
SMARTSM003897.9E-8252316IPR001356Homeobox domain
CDDcd000862.76E-11252312No hitNo description
Gene3DG3DSA:1.10.10.601.6E-25255316IPR009057Homeodomain-like
SuperFamilySSF466895.13E-16256319IPR009057Homeodomain-like
PfamPF059202.7E-17269308IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MEGHRRRQQY HHHITTPFYH VPQQSRREKL RYPSTEIDLL HPTSTTTFIG NPNYIRCFQQ  60
PMFANQTGMS LSLSSSSQYV GTDRGSDVDE SIRIAGPSRP SEPFTGYAAV LGSSKFLGPA  120
QQILKEMCSV GDGVVVGFGC GLPGDTLDFD SGNEGSVLGV KSRLVSTLDE VYRRCKQYVQ  180
QIQYVMTCFE SIAGLHDAAP YASLAIKAMA KHFHRLKNFA VVSDNGRGGE GESLGFQALQ  240
ARTTMRQQQN LWRHQRGLPE NSVAVLKAWL FEHFLHPYPT DTDKHLLAKQ SGLSRNQVSN  300
WFINARVRLW KPLVEEIHSL EMRQGRSSQV IDTVDDPTVK RLHNKQPTGV ILKSDEFHSD  360
HHHGHTNTNT NTGISLTLGL LHQTNNSKIT VPDSLPFNVA RRFGLEEEGF NDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-14258316563Homeobox protein Meis2
3k2a_B6e-14258316563Homeobox protein Meis2
4xrm_A7e-14258316563Homeobox protein Meis2
4xrm_B7e-14258316563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008811511.13e-84PREDICTED: BEL1-like homeodomain protein 9
SwissprotQ9LZM83e-66BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLA0A0K9PVR50.0A0A0K9PVR5_Z
STRINGGSMUA_Achr10P22520_0011e-83(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.12e-61TALE family protein